PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_19885
Common NameKK1_020472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 261aa    MW: 29908.2 Da    PI: 6.0512
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_19885genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK598.7e-19164212351
         RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                    ++++l dls yF+ pik+ Ak L+v+++v+K+ CR+  + RWP+Rk+ks
  C.cajan_19885 164 AKMTLGDLSDYFHIPIKETAKLLEVSTSVVKKVCRKAELYRWPQRKVKS 212
                    6899*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.322140233IPR003035RWP-RK domain
PfamPF020421.4E-17165212IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSLPHWPPSP KPFFCSCCQV LRQIIHTNGS RFDKLEIHGT IGMISHAIIR NTTPGDPSSN  60
YQMVDFCNRN KEEIKSFLKQ YCEQQNIFGY IIMKDPLSAY YDALSTGMDW AQDISDEDDD  120
LISENDVEQD QEPEPEPENE MASNARRLQV IVFVFLGSVA ERVAKMTLGD LSDYFHIPIK  180
ETAKLLEVST SVVKKVCRKA ELYRWPQRKV KSNMRKITVL RRGLANPGTR EKTRVEIQRL  240
QQEMVEYCGG LAPTGIEMLQ V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006606627.13e-85PREDICTED: uncharacterized protein LOC102660093
RefseqXP_006606628.13e-85PREDICTED: uncharacterized protein LOC102660219
TrEMBLA0A151UAE30.0A0A151UAE3_CAJCA; Uncharacterized protein
STRINGGLYMA20G01991.18e-85(Glycine max)
STRINGGLYMA20G02005.18e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-09RWP-RK domain-containing protein